Recombinant Streptavidin Protein, 52kDa INQUIRY

Cat.No: RP-5913SP
Cat# RP-5913SP
Product Name Recombinant Streptavidin Protein
Background Streptavidin is a tetrameric protein secreted by Streptomyces avidinii which binds firmly to biotin. Streptavidin is widely used in molecular biology through its unique high affinity for the vitamin biotin. The dissociation constant (Kd) of the biotin-streptavidin complex is about ~10-15 mol/L. The strong affinity recognition of biotin and biotinylated molecules has made streptavidin one of the most important components in diagnostics and laboratory kits. The streptavidin/biotin system has one of the biggest free energies of association of yet observed for noncovalent binding of a protein and small ligand in aqueous solution (K_assoc = 10**14). The complexes are also extremely stable over a wide range of temperature and pH.
Description Recombinant streptavidin protein is produced in E.coli. The molecular weight per tetramer is approximately 52kDa.
Source E.coli
AA Sequence MAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLT GRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGA EARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAAS.
Purity >98.0% as determined by SDS-PAGE and HPLC.
PHYSICAL APPEARANCE Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation Lyophilized in 10mM potassium phosphate buffer pH 6.5.
Solubility It is recommended to reconstitute the lyophilized recombinant streptavidin protein in sterile 18M-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Storage Recombinant streptavidin protein is shipped at ambient temperature, upon arrival store at -20°C.
Online Inquiry