Recombinant Rat Tpc1808 Protein INQUIRY

Cat.No: RP-2400R
Cat# RP-2400R
Product Name Recombinant Rat Tpc1808 Protein
Synonym Tropic 1808, Tpc1808.
Background Tropic 1808 is a candidate chemotropic factor induced by nerve injury. Tpc1808 protein, similar to NGF, could promote the expression of NF-H in a time-dependent manner. Tpc1808 is the gene related to promotion of nerve growth, and both the Tpc1808 gene and the Tpc1808 recombinant protein up-regulate the expression of NF-H in PC12 cells.
Description Tropic-1808 Rat Recombinant protein fused to N-terminal His-Tag produced in E.coli is a single, non-glycosylated polypeptide chain containing 285 amino acids and having a molecular mass of 29.1 kDa. The Tpc1808 is purified by proprietary chromatographic techniques.
Source E.coli
AA Sequence MSYYHHHHHHMNLAQIAALNQISNLNAIRVGQVLKVSNAAGSNNTQNTTQPS AGVPTNTASSTTGYTVKSGDTLSAIAAANGVSLANLLSWNNLSLQAIIYPGQKL TIQNANNATVTTPNAPTSTPTVMPSTNGSYTVKSGDTLYGIAAKLGTNVQTLLS LNGLQLSSTIYVGQVLKTTGAVAGAGTATSTPTPVTPTVSKPAAANGVSTAGLS AAQAAWLRTAVVDAQAATAGTGVLASVTVAQAILESGWGQSALASAPYHNF NLYLIKVKNTWKLMTLLLS.
Purity >95.0% as determined by(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
PHYSICAL APPEARANCE Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation The Tropic-1808 was lyophilized from 1X PBS, pH 7.4.
Storage Lyophilized Tpc1808 although stable 10°C for 1 week, should be stored desiccated below -18°C. Please prevent freeze-thaw cycles.
Online Inquiry