Recombinant Protein G INQUIRY

Cat.No: RP-5237P
Cat# RP-5237P
Product Name Recombinant Protein G
Description Recombinant streptococcal protein G lacking the albumin binding region thereby avoiding undesirable reactions with albumin, though the Fc binding domain is still present. The recombinant Protein G is produced in Escherichia coli using sequence from Streptococcus C1-C2-C3. The Protein G contains 200 amino acids (190-384 and five additional residues not including methionine) having a molecular mass of 21.8kDa. The Protein-G migrates on SDS-PAGE around 32kDa.
Source E.coli
AA Sequence LPKTDTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDAT KTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTEAVDAATAEKVFK QYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTL KGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE.
Purity >96% as determined by SDS-PAGE and RP-HPLC.
PHYSICAL APPEARANCE Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation Lyophilized white powder containing no additives.
Solubility Reconstitution with deionized water or PBS.
Online Inquiry