Recombinant Human C10orf18 Protein, His Tag INQUIRY

Cat.No: PRS-994H
Cat# PRS-994H
Product Name Recombinant Human C10orf18 Protein, His Tag
Source E. coli
AA Sequence NSQRNHTVSFHLNKLKYNSTVKESRNDISLILNEYAEFNKVMKNSNQFIFQDKELNDVSGEATAQEMYLPFPGRSASYEDIIIDVCTNLHVKLRSVVKEACKSTFLFY
LVETEDKSFFVRTKNLLRKGGHTEIEPQHFCQAFHRENDTLIIIIRNEDISSHLHQIPSLLKLKHFPSVIFAGVDSPGDVLDHTYQELFRAGGFVISDDKILEAVTLVQLK
EIIKILEKLNGNGRWKWLLHYRENKKLKEDERVDSTAHKKNIMLKSFQSANIIELLHYHQCDSRSSTKAEILKCLLNLQIQHIDARFAVLLTDKPTIPREVFENNGILVTD
VNNFIENIEKIAAPFRSSYW (C-350aa encoded by BC001759)
Endotoxin Please contact us for more information.
Formulation Protein lyophilized in sterile PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, 300 mM Imidazole, pH 8.0). Trehalose (5-8%) and 10% glycerol.
Reconstitution Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Shipping The product is shipped with ice packs. Upon receipt, store it immediately at -20°C to -80°C.
Stability Aliquot and store at -20°C to -80°C for up to 6 months. Avoid freeze thaw cycles.
Storage Short-term storage: Store at 2-8°C for two weeks. Long-term storage: Aliquot and store at -20°C to -80°C for up to 6 months, buffer containing 50% glycerol recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Online Inquiry