Recombinant Human C10orf125 Protein, His Tag INQUIRY

Cat.No: PRS-992H
Cat# PRS-992H
Product Name Recombinant Human C10orf125 Protein, His Tag
Source E. coli
AA Sequence MVALKGVPALLSPELLYALARMGHGDEIVLADLNFPASSICQCGPMEIRADGLGIPQLLEAVLKLLPLDTYVESPAAVMELVPSDKERGLQTPVWTEYESILRRAGCVRALAKIERFEFYERAKKAFAVVATGC (1 - 134 aa encoded by BC129819)
Endotoxin Please contact us for more information.
Purity 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Formulation Protein lyophilized in sterile PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, 300 mM Imidazole, pH 8.0). Trehalose (5-8%) and 10% glycerol.
Reconstitution Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Shipping The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature
Stability Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage Short-term storage: Store at 2-8°C for two weeks. Long-term storage: Aliquot and store at -20°C to -80°C for up to 6 months, buffer containing 50% glycerol recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Online Inquiry