Recombinant Human BVES Protein, GST Tag INQUIRY

Cat.No: PRS-981H
Cat# PRS-981H
Product Name Recombinant Human BVES Protein, GST Tag
Source E. coli
AA Sequence LYKKRPVKIEKELSGMYRRLFEPLRVPPDLFRRLTGQFCMIQTLKKGQTYAAEDKTSVDDRLSILLKGKMKVSYRGHFLHNIYPCAFIDSPEFRSTQMHKGEKFQVTIIADDNCRFLCWSRERLTYFLESEPFLYEIFRYLIGKDITNKLYSLNDPTLNDKKAKKLEHQLSLCTQISMLEMRNSIASSSDSDDGLHQFLRGTSSMSSLHVSSPHQRASAKMKPIEEGAEDDDDVFEPASPNTLKVHQLP (112-360aa encoded by BC034425)
Endotoxin Please contact us for more information.
Formulation Protein lyophilized in sterile PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, 100 mM GSH, pH 8.0) and 10% glycerol.
Reconstitution Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Shipping The product is shipped with ice packs. Upon receipt, store it immediately at -20°C to -80°C.
Stability Aliquot and store at -20°C to -80°C for up to 6 months. Avoid freeze thaw cycles.
Storage Short-term storage: Store at 2-8°C for two weeks. Long-term storage: Aliquot and store at -20°C to -80°C for up to 6 months, buffer containing 50% glycerol recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Online Inquiry